Structure of PDB 8auv Chain V

Receptor sequence

>8auvV (length=55) Species: 4097 (Nicotiana tabacum) [Search protein sequence]

GHSNIWNAHPKNYGPGSRTCRVCGNPHAIIRKYGLMCCRQCFRSNAKEIG
FIKYR

3D structure

PDB

8auv Structure of the actively translating plant 80S ribosome at 2.2 angstrom resolution.

Chain

Resolution

2.38 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	V	G2 H3 I6 W7 N8 H10 P11 Y14 G15 P16 G17 R19 C24 N26 H28 A29 I31 R32 K33 Y34 R40 Q41 R44 K54 Y55 R56	G1 H2 I5 W6 N7 H9 P10 Y13 G14 P15 G16 R18 C23 N25 H27 A28 I30 R31 K32 Y33 R39 Q40 R43 K53 Y54 R55
BS02	ZN	V	C21 C24 C39 C42	C20 C23 C38 C41

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0008270	zinc ion binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links