Structure of PDB 7yq2 Chain V

Receptor sequence
>7yq2V (length=137) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence]
AELTPEVLTVPLNSEGKTITLTEKQYLEGKRLFQYACASCHVGGITKTNP
SLDLRTETLALATPPRDNIEGLVDYMKNPTTYDGEQEIAEVHPSLRSADI
FPKMRNLTEKDLVAIAGHILVEPKILGDKWGGGKVYY
3D structure
PDB7yq2 Crystal structures of photosystem II from a cyanobacterium expressing psbA 2 in comparison to psbA 3 reveal differences in the D1 subunit.
ChainV
Resolution1.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 HEC V A36 C37 C40 H41 T46 T48 L52 D53 L54 L59 Y75 M76 Y82 H92 P93 A36 C37 C40 H41 T46 T48 L52 D53 L54 L59 Y75 M76 Y82 H92 P93
BS02 GOL V Q86 I88 E90 Q86 I88 E90
BS03 GOL V R55 D128 R55 D128
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0009055 electron transfer activity
GO:0020037 heme binding
Biological Process
GO:0015979 photosynthesis
GO:0022904 respiratory electron transport chain
Cellular Component
GO:0009523 photosystem II
GO:0042651 thylakoid membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7yq2, PDBe:7yq2, PDBj:7yq2
PDBsum7yq2
PubMed36334624
UniProtP0A386|CY550_THEVB Photosystem II extrinsic protein V (Gene Name=psbV)

[Back to BioLiP]