Structure of PDB 7xvm Chain V

Receptor sequence
>7xvmV (length=84) Species: 9031 (Gallus gallus) [Search protein sequence]
SRRSASHPTYSEMIAAAIRAEKSRGGSSRQSIQKYIKSHYKVGHNADLQI
KLSIRRLLAAGVLKQTKGVGASGSFRLAKSDKAK
3D structure
PDB7xvm Crystal Structure of Nucleosome-H1.0 Linker Histone Assembly (sticky-169a DNA fragment)
ChainV
Resolution2.84 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna V R48 K70 A90 R29 K51 A71
BS02 dna V S47 Q49 K83 T85 K86 S93 R95 K101 A102 S28 Q30 K64 T66 K67 S74 R76 K82 A83
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003690 double-stranded DNA binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
Biological Process
GO:0006325 chromatin organization
GO:0006334 nucleosome assembly
GO:0030261 chromosome condensation
GO:0045910 negative regulation of DNA recombination
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7xvm, PDBe:7xvm, PDBj:7xvm
PDBsum7xvm
PubMed
UniProtP02259|H5_CHICK Histone H5

[Back to BioLiP]