Structure of PDB 7xti Chain V |
>7xtiV (length=106) Species: 460519 (Komagataella phaffii) [Search protein sequence] |
RERACMLCGIVLPGRVFMQNGCPNCDSVLNLRDSDQATVNECTSSSFEGL VAVGDNEHSWVAKWLRVDRFQPGLYAVRVDGRLPSDIVAALEQYGVYYRP RDGSVI |
|
PDB | 7xti Structural basis of nucleosome disassembly and reassembly by RNAPII elongation complex with FACT. |
Chain | V |
Resolution | 3.9 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
V |
C12 C15 C29 C32 |
C5 C8 C22 C25 |
|
|
|
|