Structure of PDB 7wbv Chain V |
>7wbvV (length=102) Species: 460519 (Komagataella phaffii) [Search protein sequence] |
ERACMLCGIVLPGRVFMQNGCPNCDSVLNLRDSDQATVNECTSSSFEGLV AVGDNEHSWVAKWLRVDRFQPGLYAVRVDGRLPSDIVAALEQYGVYYRPR DG |
|
PDB | 7wbv Structural Basis of Damaged Nucleotide Recognition by Transcribing RNA Polymerase II in the Nucleosome. |
Chain | V |
Resolution | 4.1 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
V |
C12 C15 C32 |
C4 C7 C24 |
|
|
|
|