Structure of PDB 7v9k Chain V |
>7v9kV (length=99) Species: 9606 (Homo sapiens) [Search protein sequence] |
KKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGE ASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK |
|
PDB | 7v9k Columnar structure of human telomeric chromatin. |
Chain | V |
Resolution | 8.1 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
dna |
V |
R26 R30 |
R3 R7 |
|
|
|
|