Structure of PDB 7uw1 Chain V

Receptor sequence

>7uw1V (length=76) Species: 480119 (Acinetobacter baumannii AB0057) [Search protein sequence]

STKNGRDSNPKMLGVKVYGGQTVTAGNIIVRQRGTEFHAGANVGMGRDHT
LFATADGVVKFEVKGQFGRRYVKVET

3D structure

PDB

7uw1 Streptothricin F is a bactericidal antibiotic effective against highly drug-resistant gram-negative bacteria that interacts with the 30S subunit of the 70S ribosome.

Chain

Resolution

2.21 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	V	S9 T10 N12 R14 D15 S16 N17 P18 K19 M20 K24 Y26 G27 Q29 A33 G34 N35 I36 R39 R41 G42 T43 E44 G54 R55 D56 H57 F60 R77 R78	S1 T2 N4 R6 D7 S8 N9 P10 K11 M12 K16 Y18 G19 Q21 A25 G26 N27 I28 R31 R33 G34 T35 E36 G46 R47 D48 H49 F52 R69 R70
BS02	rna	V	K72 G73 Q74	K64 G65 Q66

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7uw1, PDBe:7uw1, PDBj:7uw1
PDBsum	7uw1
PubMed	37192172
UniProt	B7I6V8\|RL27_ACIB5 Large ribosomal subunit protein bL27 (Gene Name=rpmA)

[Back to BioLiP]