Structure of PDB 7uvz Chain V

Receptor sequence
>7uvzV (length=76) Species: 480119 (Acinetobacter baumannii AB0057) [Search protein sequence]
STKNGRDSNPKMLGVKVYGGQTVTAGNIIVRQRGTEFHAGANVGMGRDHT
LFATADGVVKFEVKGQFGRRYVKVET
3D structure
PDB7uvz Streptothricin F is a bactericidal antibiotic effective against highly drug-resistant gram-negative bacteria that interacts with the 30S subunit of the 70S ribosome.
ChainV
Resolution2.21 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna V S9 N12 R14 D15 S16 N17 P18 K19 M20 K24 Y26 G27 Q29 A33 G34 N35 I36 R39 R41 G42 T43 E44 G54 R55 D56 H57 F60 R77 S1 N4 R6 D7 S8 N9 P10 K11 M12 K16 Y18 G19 Q21 A25 G26 N27 I28 R31 R33 G34 T35 E36 G46 R47 D48 H49 F52 R69
BS02 rna V K72 G73 Q74 K64 G65 Q66
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7uvz, PDBe:7uvz, PDBj:7uvz
PDBsum7uvz
PubMed37192172
UniProtB7I6V8|RL27_ACIB5 Large ribosomal subunit protein bL27 (Gene Name=rpmA)

[Back to BioLiP]