Structure of PDB 7ttw Chain V

Receptor sequence

>7ttwV (length=143) Species: 1280 (Staphylococcus aureus)

RQTFMANESNIERKWYVIDAEGQTLGRLSSEVASILRGKNKVTYTPHVDT
GDYVIVINASKIEFTGNKETDKVYYRHSNHPGGIKSITAGELRRTNPERL
IENSIKGMLPSTRLGEKQGKKLFVYGGAEHPHAAQQPENYELR

3D structure

• PDB: 7ttw A Structurally Characterized Staphylococcus aureus Evolutionary Escape Route from Treatment with the Antibiotic Linezolid.
• Chain: V
• Resolution: 2.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	V	R2 T4 M6 G27 R28 S31 R38 K40 H48 T66 K69 Y75 Y76 R77 H78 S79 H81 G83 R100 E103 S105 G108 M109 P111 R114 K121 H133 A135 Q136 R144	R1 T3 M5 G26 R27 S30 R37 K39 H47 T65 K68 Y74 Y75 R76 H77 S78 H80 G82 R99 E102 S104 G107 M108 P110 R113 K120 H132 A134 Q135 R143

Gene Ontology

Molecular Function

• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation
• GO:0017148 negative regulation of translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7ttw, PDBe:7ttw, PDBj:7ttw
• PDBsum: 7ttw
• PubMed: 35736238
• UniProt: Q2FW38|RL13_STAA8 Large ribosomal subunit protein uL13 (Gene Name=rplM)