Structure of PDB 7rcv Chain V

Receptor sequence
>7rcvV (length=135) Species: 1111708 (Synechocystis sp. PCC 6803 substr. Kazusa) [Search protein sequence]
VELTESTRTIPLDEAGGTTTLTARQFTNGQKIFVDTCTQCHLQGKTKTNN
NVSLGLADLAGAEPRRDNVLALVEFLKNPKSYDGEDDYSELHPNISRPDI
YPEMRNYTEDDIFDVAGYTLIAPKLDERWGGTIYF
3D structure
PDB7rcv High-resolution cryo-electron microscopy structure of photosystem II from the mesophilic cyanobacterium, Synechocystis sp. PCC 6803.
ChainV
Resolution2.01 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEM V C62 C65 H66 T71 V77 S78 L79 D83 L84 R91 F100 L101 Y107 Y113 H117 P118 M129 C37 C40 H41 T46 V52 S53 L54 D58 L59 R66 F75 L76 Y82 Y88 H92 P93 M104
BS02 CA V Q64 E128 Q39 E103
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0009055 electron transfer activity
GO:0020037 heme binding
Biological Process
GO:0015979 photosynthesis
GO:0022904 respiratory electron transport chain
Cellular Component
GO:0009523 photosystem II
GO:0042651 thylakoid membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7rcv, PDBe:7rcv, PDBj:7rcv
PDBsum7rcv
PubMed34937700
UniProtQ55013|CY550_SYNY3 Photosystem II extrinsic protein V (Gene Name=psbV)

[Back to BioLiP]