Structure of PDB 7ohw Chain V

Receptor sequence
>7ohwV (length=98) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
MNCADNSGARNLYIAASLGDMVMATVKKELRKKVMPAIVVRQAKSWRRRD
GVFLYFEDNAGVIANPKGEMKGSAITGPVGKECADLWPRVASNSGVVV
3D structure
PDB7ohw Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.
ChainV
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna V R86 R88 F92 R47 R49 F53
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ohw, PDBe:7ohw, PDBj:7ohw
PDBsum7ohw
PubMed34813592
UniProtP0CX41|RL23A_YEAST Large ribosomal subunit protein uL14A (Gene Name=RPL23A)

[Back to BioLiP]