Structure of PDB 7ohp Chain V |
>7ohpV (length=126) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] |
RISLGLPVGAIMNCADNSGARNLYIIAVKGSGSRLNRLPAASLGDMVMAT VKKGKPELRKKVMPAIVVRQAKSWRRRDGVFLYFEDNAGVIANPKGEMKG SAITGPVGKECADLWPRVASNSGVVV |
|
PDB | 7ohp Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors. |
Chain | V |
Resolution | 3.9 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
V |
R12 S44 R45 R88 |
R1 S33 R34 R77 |
|
|
|
|