Structure of PDB 7nhn Chain V

Receptor sequence

>7nhnV (length=110) Species: 169963 (Listeria monocytogenes EGD-e)

TSAKAVAKTVRIAPRKARIVIDLIRGKQVGEAIAILKYTPRSASPIIEKV
LKSAIANAEHNYDLDINNLVVEEAFVDEGPTLKRFRPRAQGRASAINKRT
SHITVVVSEV

3D structure

• PDB: 7nhn Structural basis of ABCF-mediated resistance to pleuromutilin, lincosamide, and streptogramin A antibiotics in Gram-positive pathogens.
• Chain: V
• Resolution: 2.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	V	K9 V11 A12 K13 R16 R20 K21 R23 R30 P45 R46 S47 K54 S58 A61 N62 H65 N66 Y67 D82 E83 K88 R89 R91 P92 R93 A94 Q95 G96 R97 A98 S99 A100 I101 N102 R104	K4 V6 A7 K8 R11 R15 K16 R18 R25 P40 R41 S42 K49 S53 A56 N57 H60 N61 Y62 D77 E78 K83 R84 R86 P87 R88 A89 Q90 G91 R92 A93 S94 A95 I96 N97 R99

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7nhn, PDBe:7nhn, PDBj:7nhn
• PDBsum: 7nhn
• PubMed: 34117249
• UniProt: Q927L2|RL22_LISMO Large ribosomal subunit protein uL22 (Gene Name=rplV)