Structure of PDB 7c06 Chain V

Receptor sequence
>7c06V (length=174) Species: 284812 (Schizosaccharomyces pombe 972h-) [Search protein sequence]
VNCSFYYKIGACRHGERCSRKHVKPNFSQTILCPNMYKNPIHGKKFTQRE
LAEQFDAFYEDMFCEFSKYGEVEQLVVCDNVGDHLVGNVYVRFKYEESAQ
NAIDDLNSRWYSQRPVYAELSPVTDFREACCRQHETSECQRGGLCNFMHA
KKPSPQLLRDLVLAQRKYLALNAA
3D structure
PDB7c06 Elucidation of the aberrant 3' splice site selection by cancer-associated mutations on the U2AF1.
ChainV
Resolution3.02 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna V S19 F20 K23 H29 C33 S34 R35 E146 C148 C149 Q151 R159 N164 F165 S4 F5 K8 H14 C18 S19 R20 E128 C130 C131 Q133 R141 N146 F147
BS02 ZN V C18 C27 C33 H37 C3 C12 C18 H22
BS03 ZN V C149 C163 H167 C131 C145 H149
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0030628 pre-mRNA 3'-splice site binding
GO:0046872 metal ion binding
Biological Process
GO:0000389 mRNA 3'-splice site recognition
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0045292 mRNA cis splicing, via spliceosome
Cellular Component
GO:0000243 commitment complex
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005829 cytosol
GO:0071004 U2-type prespliceosome
GO:0089701 U2AF complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7c06, PDBe:7c06, PDBj:7c06
PDBsum7c06
PubMed32958768
UniProtQ09176|U2AF1_SCHPO Splicing factor U2AF 23 kDa subunit (Gene Name=SPAP8A3.06)

[Back to BioLiP]