Structure of PDB 7bog Chain V

Receptor sequence
>7bogV (length=99) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
GRPQRVAQEMQKEIALILQREIKDPRLGMMTTVSGVEMSRDLAYAKVYVT
FLNDKDEDAVKAGIKALQEASGFIRSLLGKAMRLRIVPELTFFYDNSLV
3D structure
PDB7bog A conserved rRNA switch is central to decoding site maturation on the small ribosomal subunit.
ChainV
Resolution2.75 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna V R10 I27 K28 D29 P30 R31 R45 D46 Y49 F78 R80 S81 R90 I91 V92 R5 I22 K23 D24 P25 R26 R40 D41 Y44 F73 R75 S76 R85 I86 V87
Gene Ontology
Molecular Function
GO:0043024 ribosomal small subunit binding
Biological Process
GO:0006364 rRNA processing
GO:0006974 DNA damage response
GO:0009409 response to cold
GO:0030490 maturation of SSU-rRNA
GO:0042254 ribosome biogenesis
GO:0042274 ribosomal small subunit biogenesis
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7bog, PDBe:7bog, PDBj:7bog
PDBsum7bog
PubMed34088665
UniProtP0A7G2|RBFA_ECOLI 30S ribosome-binding factor (Gene Name=rbfA)

[Back to BioLiP]