Structure of PDB 7aso Chain V

Receptor sequence
>7asoV (length=112) Species: 1280 (Staphylococcus aureus) [Search protein sequence]
MEAKAVARTIRIAPRKVRLVLDLIRGKNAAEAIAILKLTNKASSPVIEKV
LMSALANAEHNYDMNTDELVVKEAYANEGPTLKRFRPRAQGRASAINKRT
SHITIVVSDGKE
3D structure
PDB7aso Staphylococcus aureus 70S after 30 minutes incubation a 37C
ChainV
Resolution3.11 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna V V6 A7 R8 T9 R15 K16 R18 K41 A42 K49 A56 N57 H60 N61 N77 E78 P87 R88 A89 Q90 G91 R92 A93 A95 V6 A7 R8 T9 R15 K16 R18 K41 A42 K49 A56 N57 H60 N61 N77 E78 P87 R88 A89 Q90 G91 R92 A93 A95
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Fri Feb 28 14:17:00 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7aso', asym_id = 'V', title = 'Staphylococcus aureus 70S after 30 minutes incubation a 37C'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7aso', asym_id='V', title='Staphylococcus aureus 70S after 30 minutes incubation a 37C')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0005840,0006412,0015934', uniprot = '', pdbid = '7aso', asym_id = 'V'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412,0015934', uniprot='', pdbid='7aso', asym_id='V')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>