Structure of PDB 7aqr Chain V

Receptor sequence

>7aqrV (length=140) Species: 3702 (Arabidopsis thaliana)

AKVKQTTGIVGLDVVPNARAVLIDLYSKTLKEIQAVPEDEGYRKAVESFT
RQRLNVCKEEEDWEMIEKRLGCGQVEELIEEARDELTLIGKMIEWDPWGV
PDDYECEVIENDAPIPKHVPQHRPGPLPEQFYKTLEGLIA

3D structure

• PDB: 7aqr A ferredoxin bridge connects the two arms of plant mitochondrial complex I.
• Chain: V
• Resolution: 2.91 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	V	E116 C117 V119 E121	E105 C106 V108 E110

Gene Ontology

Molecular Function

• GO:0005515 protein binding

Biological Process

• GO:0009853 photorespiration
• GO:0022904 respiratory electron transport chain

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0009536 plastid
• GO:0031966 mitochondrial membrane
• GO:0045271 respiratory chain complex I

External links

• PDB: RCSB:7aqr, PDBe:7aqr, PDBj:7aqr
• PDBsum: 7aqr
• PubMed: 33768254
• UniProt: Q9FLX7|NDUA5_ARATH Probable NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5, mitochondrial (Gene Name=At5g52840)