Structure of PDB 7aqc Chain V

Receptor sequence

>7aqcV (length=82) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168)

SKKGVGSTKNGRDSEAKRLGAKRADGQFVTGGSILYRQRGTKIYPGENVG
RGGDDTLFAKIDGTVKFERFGRDRKKVSVYPV

3D structure

• PDB: 7aqc Mimicry of Canonical Translation Elongation Underlies Alanine Tail Synthesis in RQC.
• Chain: V
• Resolution: 2.99 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	V	S11 K12 T18 N20 R22 S24 E25 A26 K27 R28 L29 K32 A34 D35 G36 Q37 T40 G41 G42 S43 I44 Y46 R47 R49 T51 Y54 G62 G63 D64 F68 F77 R84 K85	S1 K2 T8 N10 R12 S14 E15 A16 K17 R18 L19 K22 A24 D25 G26 Q27 T30 G31 G32 S33 I34 Y36 R37 R39 T41 Y44 G52 G53 D54 F58 F67 R74 K75
BS02	rna	V	R79 F80 G81 R82	R69 F70 G71 R72
BS03	rna	V	G14 G16	G4 G6

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7aqc, PDBe:7aqc, PDBj:7aqc
• PDBsum: 7aqc
• PubMed: 33259811
• UniProt: P05657|RL27_BACSU Large ribosomal subunit protein bL27 (Gene Name=rpmA)