Structure of PDB 7a09 Chain V

Receptor sequence

>7a09V (length=296) Species: 9606 (Homo sapiens) [Search protein sequence]

QMTLRGTLKGHNGWVTQIATTPQFPDMILSASRDKTIIMWKLTRDETNYG
IPQRALRGHSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVG
HTKDVLSVAFSSDNRQIVSGSRDKTIKLWNTLGVCKYTVQDESHSEWVSC
VRFSPPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLNTVTVSPDGSLC
ASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIK
IWDLEGKIIVDELKQEPPQCTSLAWSADGQTLFAGYTDNLVRVWQV

3D structure

PDB

7a09 A structural inventory of native ribosomal ABCE1-43S pre-initiation complexes.

Chain

Resolution

3.5 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	V	G61 R88 R100	G58 R85 R97

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0005080	protein kinase C binding
GO:0005102	signaling receptor binding
GO:0005515	protein binding
GO:0008047	enzyme activator activity
GO:0008200	ion channel inhibitor activity
GO:0008656	cysteine-type endopeptidase activator activity involved in apoptotic process
GO:0019899	enzyme binding
GO:0019903	protein phosphatase binding
GO:0030292	protein tyrosine kinase inhibitor activity
GO:0030332	cyclin binding
GO:0030971	receptor tyrosine kinase binding
GO:0035591	signaling adaptor activity
GO:0042169	SH2 domain binding
GO:0042802	identical protein binding
GO:0042803	protein homodimerization activity
GO:0043022	ribosome binding
GO:0045182	translation regulator activity
GO:0045296	cadherin binding
GO:0051434	BH3 domain binding
GO:0060090	molecular adaptor activity

	Biological Process
GO:0001934	positive regulation of protein phosphorylation
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0006417	regulation of translation
GO:0006915	apoptotic process
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0007369	gastrulation
GO:0010629	negative regulation of gene expression
GO:0016567	protein ubiquitination
GO:0017148	negative regulation of translation
GO:0030178	negative regulation of Wnt signaling pathway
GO:0030308	negative regulation of cell growth
GO:0030335	positive regulation of cell migration
GO:0031334	positive regulation of protein-containing complex assembly
GO:0032091	negative regulation of protein binding
GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0032880	regulation of protein localization
GO:0033137	negative regulation of peptidyl-serine phosphorylation
GO:0042998	positive regulation of Golgi to plasma membrane protein transport
GO:0043065	positive regulation of apoptotic process
GO:0043473	pigmentation
GO:0043547	positive regulation of GTPase activity
GO:0045879	negative regulation of smoothened signaling pathway
GO:0048511	rhythmic process
GO:0050765	negative regulation of phagocytosis
GO:0051302	regulation of cell division
GO:0051726	regulation of cell cycle
GO:0051898	negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction
GO:0051901	positive regulation of mitochondrial depolarization
GO:0071333	cellular response to glucose stimulus
GO:0071363	cellular response to growth factor stimulus
GO:0072344	rescue of stalled ribosome
GO:0106070	regulation of adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:1900102	negative regulation of endoplasmic reticulum unfolded protein response
GO:1903751	negative regulation of intrinsic apoptotic signaling pathway in response to hydrogen peroxide
GO:2000114	regulation of establishment of cell polarity
GO:2000543	positive regulation of gastrulation
GO:2001244	positive regulation of intrinsic apoptotic signaling pathway

	Cellular Component
GO:0001891	phagocytic cup
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005737	cytoplasm
GO:0005739	mitochondrion
GO:0005829	cytosol
GO:0005840	ribosome
GO:0005886	plasma membrane
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:0030425	dendrite
GO:0030496	midbody
GO:0042995	cell projection
GO:0043005	neuron projection
GO:0043025	neuronal cell body
GO:0043204	perikaryon
GO:0044297	cell body
GO:0048471	perinuclear region of cytoplasm
GO:0070062	extracellular exosome
GO:1990630	IRE1-RACK1-PP2A complex
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7a09, PDBe:7a09, PDBj:7a09
PDBsum	7a09
PubMed	33289941
UniProt	P63244\|RACK1_HUMAN Small ribosomal subunit protein RACK1 (Gene Name=RACK1)

[Back to BioLiP]