Structure of PDB 6yal Chain V

Receptor sequence

>6yalV (length=141) Species: 9986 (Oryctolagus cuniculus)

VTVKDVNQQEFVRALAAFLKKSGKLKVPEWVDTVKLAKHKELAPYDENWF
YTRAASTARHLYLRGGAGVGSMTKIYGGRQRNGVMPSHFSRGSKSVARRV
LQALEGLKMVEKDQDWGRKLTPQGQRDLDRIAGQVAAAKKK

3D structure

• PDB: 6yal Structural Insights into the Mammalian Late-Stage Initiation Complexes.
• Chain: V
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	V	V4 K7 Q12 W33 K38 K43 L45 P47 Y48 R56 S59 R62 R67 G71 V72 S74 K77 R84 V87 M88 H91 F92 S96 K97 S98 R101 R102 Q105 K115 W119 R121 Q128 R129	V1 K4 Q9 W30 K35 K40 L42 P44 Y45 R53 S56 R59 R64 G68 V69 S71 K74 R81 V84 M85 H88 F89 S93 K94 S95 R98 R99 Q102 K112 W116 R118 Q125 R126

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000028 ribosomal small subunit assembly
• GO:0006412 translation

Cellular Component

• GO:0005634 nucleus
• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022626 cytosolic ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6yal, PDBe:6yal, PDBj:6yal
• PDBsum: 6yal
• UniProt: G1TN62|RS19_RABIT Small ribosomal subunit protein eS19 (Gene Name=RPS19)