Structure of PDB 6wqn Chain V

Receptor sequence

>6wqnV (length=143) Species: 1280 (Staphylococcus aureus) [Search protein sequence]

RQTFMANESNIERKWYVIDAEGQTLGRLSSEVASILRGKNKVTYTPHVDT
GDYVIVINASKIEFTGNKETDKVYYRHSNHPGGIKSITAGELRRTNPERL
IENSIKGMLPSTRLGEKQGKKLFVYGGAEHPHAAQQPENYELR

3D structure

PDB

6wqn Characterization of the Core Ribosomal Binding Region for the Oxazolidone Family of Antibiotics Using Cryo-EM.

Chain

Resolution

2.9 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	V	R2 T4 N8 L26 G27 R28 S31 R38 K40 H48 T66 K69 K73 Y75 Y76 R77 H78 S79 H81 P82 G83 K86 E103 S105 M109 R114 L115 K121 H133 A135 Q136 Q137	R1 T3 N7 L25 G26 R27 S30 R37 K39 H47 T65 K68 K72 Y74 Y75 R76 H77 S78 H80 P81 G82 K85 E102 S104 M108 R113 L114 K120 H132 A134 Q135 Q136

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation
GO:0017148	negative regulation of translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:6wqn, PDBe:6wqn, PDBj:6wqn
PDBsum	6wqn
PubMed	32566908
UniProt	Q2FW38\|RL13_STAA8 Large ribosomal subunit protein uL13 (Gene Name=rplM)