Structure of PDB 6wm2 Chain V

Receptor sequence
>6wm2V (length=50) Species: 9606 (Homo sapiens) [Search protein sequence]
SPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIY
3D structure
PDB6wm2 Structures of a Complete Human V-ATPase Reveal Mechanisms of Its Assembly.
ChainV
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 WSS V Y299 Y303 Y9 Y13
BS02 WSS V V305 W312 V15 W22
BS03 WSS V Y303 V310 Y13 V20
BS04 WSS V Y297 Y299 Y303 Y7 Y9 Y13
Gene Ontology
Molecular Function
GO:0038023 signaling receptor activity
Cellular Component
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6wm2, PDBe:6wm2, PDBj:6wm2
PDBsum6wm2
PubMed33065002
UniProtO75787|RENR_HUMAN Renin receptor (Gene Name=ATP6AP2)

[Back to BioLiP]