Structure of PDB 6tmf Chain V

Receptor sequence

>6tmfV (length=149) Species: 1293037 (Thermococcus celer Vu 13 = JCM 8558)

ATVYDVPGDLLVERTAKALKEVEAIKPPEWAPFVKTGRHKERIPEQEDWW
YYRVASIFRKIYIDGPVGIERLRTWYGGRKNRGHAPEHFYKAGGSIIRKA
LQQLEAAGFVQKVPGEGRIVTPQGQSFLDRIATELKKELEEQLPELKKY

3D structure

• PDB: 6tmf Molecular analysis of the ribosome recycling factor ABCE1 bound to the 30S post-splitting complex.
• Chain: V
• Resolution: 2.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	V	A2 D10 W31 V35 K36 T37 R39 K41 E42 R43 P45 E46 Q47 R54 S57 R60 K61 D65 G69 I70 E71 R72 T75 W76 R80 K81 R83 G84 H85 A86 P87 E88 H89 F90 G95 S96 R99 Q103 G118 R119 P123 Q126 S127 D130 T134	A1 D9 W30 V34 K35 T36 R38 K40 E41 R42 P44 E45 Q46 R53 S56 R59 K60 D64 G68 I69 E70 R71 T74 W75 R79 K80 R82 G83 H84 A85 P86 E87 H88 F89 G94 S95 R98 Q102 G117 R118 P122 Q125 S126 D129 T133

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000028 ribosomal small subunit assembly
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6tmf, PDBe:6tmf, PDBj:6tmf
• PDBsum: 6tmf
• PubMed: 32064661
• UniProt: A0A218P4W7