Structure of PDB 6snt Chain V

Receptor sequence
>6sntV (length=87) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
MENDKGQLVELYVPRKCSATNRIIKADDHASVQINVAKVDEEGRAIPGEY
VTYALSGYVRSRGESDDSLNRLAQNDGLLKNVWSYSR
3D structure
PDB6snt RQT complex dissociates ribosomes collided on endogenous RQC substrate SDD1.
ChainV
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna V Y58 R62 Y58 R62
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000447 endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000461 endonucleolytic cleavage to generate mature 3'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006364 rRNA processing
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6snt, PDBe:6snt, PDBj:6snt
PDBsum6snt
PubMed32203490
UniProtP0C0V8|RS21A_YEAST Small ribosomal subunit protein eS21A (Gene Name=RPS21A)

[Back to BioLiP]