Structure of PDB 6r84 Chain V

Receptor sequence

>6r84V (length=159) Species: 4932 (Saccharomyces cerevisiae)

GKSHGYRSRTRYMFQRDFRKHGAVHLSTYLKVYKVGDIVDIKANGSIQKG
MPHKFYQGKTGVVYNVTKSSVGVIINKMVGNRYLEKRLNLRVEHIKHSKC
RQEFLERVKANAAKRAEAKAQGVAVQLKRQPAQPRESRIVSTEGNVPQTL
APVPYETFI

3D structure

• PDB: 6r84 Structure and function of Vms1 and Arb1 in RQC and mitochondrial proteome homeostasis.
• Chain: V
• Resolution: 3.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	V	R20 H26 L27 S28	R19 H25 L26 S27
BS02	rna	V	G2 S4 H5 G6 Y7 R8 S9 R10 R12 Y13 M14 Q16 R17 F19 H22 G23 K35 D41 K43 G46 S47 Q49 K50 H54 K55 F56 Y57 Q58 K60 T61 T68 K69 S70 S71 K78 R83 L85 K87 R88 C101 E104 F105 R108 V109 R116 Q127 L128 K129 R130 P132	G1 S3 H4 G5 Y6 R7 S8 R9 R11 Y12 M13 Q15 R16 F18 H21 G22 K34 D40 K42 G45 S46 Q48 K49 H53 K54 F55 Y56 Q57 K59 T60 T67 K68 S69 S70 K77 R82 L84 K86 R87 C100 E103 F104 R107 V108 R115 Q126 L127 K128 R129 P131

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6r84, PDBe:6r84, PDBj:6r84
• PDBsum: 6r84
• PubMed: 31189955
• UniProt: Q02753|RL21A_YEAST Large ribosomal subunit protein eL21A (Gene Name=RPL21A)