Structure of PDB 6ppk Chain V

Receptor sequence

>6ppkV (length=78) Species: 1423 (Bacillus subtilis)

SKKGVNGRDSEAKRLGAKRADGQFVTGGSILYRQRGTKIYPGENVGRGGD
DTLFAKIDGTVKFERFGRDRKKVSVYPV

3D structure

• PDB: 6ppk Structural consequences of the interaction of RbgA with a 50S ribosomal subunit assembly intermediate.
• Chain: V
• Resolution: 4.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	V	S11 K12 K13 G14 N20 R22 D23 S24 E25 R28 K32 R33 A34 D35 G36 Q37 G41 G42 S43 I44 R47 R49 G50 T51 Y54 G62 G63 D64 F68 K70 F77 R84 K85	S1 K2 K3 G4 N6 R8 D9 S10 E11 R14 K18 R19 A20 D21 G22 Q23 G27 G28 S29 I30 R33 R35 G36 T37 Y40 G48 G49 D50 F54 K56 F63 R70 K71

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6ppk, PDBe:6ppk, PDBj:6ppk
• PDBsum: 6ppk
• PubMed: 31665744
• UniProt: P05657|RL27_BACSU Large ribosomal subunit protein bL27 (Gene Name=rpmA)