Structure of PDB 6ppf Chain V

Receptor sequence
>6ppfV (length=73) Species: 1423 (Bacillus subtilis) [Search protein sequence]
NGRDSEAKRLGAKRADGQFVTGGSILYRQRGTKIYPGENVGRGGDDTLFA
KIDGTVKFERFGRDRKKVSVYPV
3D structure
PDB6ppf Structural consequences of the interaction of RbgA with a 50S ribosomal subunit assembly intermediate.
ChainV
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna V N20 D23 S24 E25 A26 R28 A34 D35 G36 Q37 G41 G42 S43 I44 R47 R49 G50 T51 K52 G62 G63 D64 F77 N1 D4 S5 E6 A7 R9 A15 D16 G17 Q18 G22 G23 S24 I25 R28 R30 G31 T32 K33 G43 G44 D45 F58
BS02 rna V R79 G81 R60 G62
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ppf, PDBe:6ppf, PDBj:6ppf
PDBsum6ppf
PubMed31665744
UniProtP05657|RL27_BACSU Large ribosomal subunit protein bL27 (Gene Name=rpmA)

[Back to BioLiP]