Structure of PDB 6okk Chain V

Receptor sequence

>6okkV (length=146) Species: 36329 (Plasmodium falciparum 3D7) [Search protein sequence]

DVQHERAYQKQEGASFFNSKRYWKKVGLGFATPKEAKEGVYVDKKCPFTG
NVSIRGRILKGMVISNKMKRTIIIRRNYLHYVKKYNRFEKRHKNIPCHCS
PCFDVKEGDIVTVGQCRPLSKTVRFNVLHVEKHQIFGSARKQFVLF

3D structure

PDB

6okk Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.

Chain

Resolution

3.3 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	V	E10 A12 Q14 E17 S20 N23 S24 K25 Y37 K40 V41 G42 L43 K59 K60 N66 S68 I69 R70 G71 R72 S80 K82 M83 K84 R91 Y93 H95 K98 K99 Y100 R102 K105 R106 H107 K108 N109 Q130 R132 P133 L134 S135 K136 T137 R139 F140 R155 F161	E5 A7 Q9 E12 S15 N18 S19 K20 Y22 K25 V26 G27 L28 K44 K45 N51 S53 I54 R55 G56 R57 S65 K67 M68 K69 R76 Y78 H80 K83 K84 Y85 R87 K90 R91 H92 K93 N94 Q115 R117 P118 L119 S120 K121 T122 R124 F125 R140 F146

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links