Structure of PDB 6j50 Chain V |
>6j50V (length=102) Species: 644223 (Komagataella phaffii GS115) [Search protein sequence] |
ERACMLCGIVLPGRVFMQNGCPNCDSVLNLRDSDQATVNECTSSSFEGLV AVGDNEHSWVAKWLRVDRFQPGLYAVRVDGRLPSDIVAALEQYGVYYRPR DG |
|
PDB | 6j50 Structural insight into nucleosome transcription by RNA polymerase II with elongation factors. |
Chain | V |
Resolution | 4.7 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
V |
C12 C29 |
C4 C21 |
|
|
|
|