Structure of PDB 6j4y Chain V |
>6j4yV (length=102) Species: 644223 (Komagataella phaffii GS115) [Search protein sequence] |
ERACMLCGIVLPGRVFMQNGCPNCDSVLNLRDSDQATVNECTSSSFEGLV AVGDNEHSWVAKWLRVDRFQPGLYAVRVDGRLPSDIVAALEQYGVYYRPR DG |
|
PDB | 6j4y Structural insight into nucleosome transcription by RNA polymerase II with elongation factors. |
Chain | V |
Resolution | 4.3 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
V |
C12 C15 C29 C32 |
C4 C7 C21 C24 |
|
|
|
|