Structure of PDB 6htq Chain V

Receptor sequence

>6htqV (length=82) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168)

SKKGVGSTKNGRDSEAKRLGAKRADGQFVTGGSILYRQRGTKIYPGENVG
RGGDDTLFAKIDGTVKFERFGRDRKKVSVYPV

3D structure

• PDB: 6htq Structural Basis for Regulation of the Opposing (p)ppGpp Synthetase and Hydrolase within the Stringent Response Orchestrator Rel.
• Chain: V
• Resolution: 4.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	V	T18 N20 R22 S24 E25 K27 R28 L29 K32 R33 A34 D35 Q37 G41 G42 S43 I44 R47 R49 G50 T51 K52 Y54 G63 D64 F68 R84 K85	T8 N10 R12 S14 E15 K17 R18 L19 K22 R23 A24 D25 Q27 G31 G32 S33 I34 R37 R39 G40 T41 K42 Y44 G53 D54 F58 R74 K75
BS02	rna	V	R79 G81 R82	R69 G71 R72
BS03	rna	V	G14 S17	G4 S7

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome

External links

• PDB: RCSB:6htq, PDBe:6htq, PDBj:6htq
• PDBsum: 6htq
• PubMed: 32937119
• UniProt: P05657|RL27_BACSU Large ribosomal subunit protein bL27 (Gene Name=rpmA)