Structure of PDB 6eml Chain V

Receptor sequence

>6emlV (length=188) Species: 559292 (Saccharomyces cerevisiae S288C)

GISRDSRHKRSATGAKRAQFRKKRKFELGRQPANTKIGAKRIHSVRTRGG
NKKYRALRIETGNFSWASEGISKKTRIAGVVYHPSNNELVRTNTLTKAAI
VQIDATPFRQWFEAHYGQTLGKKSKNAERKWAARAASAKIESSVESQFSA
GRLYACISSRPGQSGRCDGYILEGEELAFYLRRLTAKK

3D structure

• PDB: 6eml Cryo-EM structure of a late pre-40S ribosomal subunit fromSaccharomyces cerevisiae.
• Chain: V
• Resolution: 3.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	V	G2 I3 R5 S7 R8 H9 K10 R11 A13 T14 G15 A16 R18 A19 F21 R22 K23 K24 R25 K26 F27 L29 R31 Q32 P33 K41 R42 H44 R47 T48 R49 G50 N52 K54 R56 R59 N64 S66 S73 K75 S86 T97 K98 S136 K137 N138 R141 K142 S170 S171 R172 Q175 S176 R178 D180	G1 I2 R4 S6 R7 H8 K9 R10 A12 T13 G14 A15 R17 A18 F20 R21 K22 K23 R24 K25 F26 L28 R30 Q31 P32 K40 R41 H43 R46 T47 R48 G49 N51 K53 R55 R58 N63 S65 S72 K74 S85 T96 K97 S124 K125 N126 R129 K130 S158 S159 R160 Q163 S164 R166 D168

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:0030686 90S preribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6eml, PDBe:6eml, PDBj:6eml
• PDBsum: 6eml
• PubMed: 29155690
• UniProt: P0CX39|RS8A_YEAST Small ribosomal subunit protein eS8A (Gene Name=RPS8A)