Structure of PDB 6elz Chain V

Receptor sequence
>6elzV (length=134) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
NGAQGTKFRISLGLPVGAIMNCADNSGARNLYIIAVKGSGSRLNRLPAAS
LGDMVMATVKKGKPELRKKVMPAIVVRQAKSWRRRDGVFLYFEDNAGVIA
NPKGEMKGSAITGPVGKECADLWPRVASNSGVVV
3D structure
PDB6elz Visualizing the Assembly Pathway of Nucleolar Pre-60S Ribosomes.
ChainV
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna V T9 K10 R12 S14 G16 P18 A21 I22 K40 G41 G43 R45 L46 N47 R48 L49 K83 R86 F92 N98 T6 K7 R9 S11 G13 P15 A18 I19 K37 G38 G40 R42 L43 N44 R45 L46 K80 R83 F89 N95
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6elz, PDBe:6elz, PDBj:6elz
PDBsum6elz
PubMed29245012
UniProtP0CX41|RL23A_YEAST Large ribosomal subunit protein uL14A (Gene Name=RPL23A)

[Back to BioLiP]