Structure of PDB 5x8p Chain V

Receptor sequence

>5x8pV (length=124) Species: 3562 (Spinacia oleracea) [Search protein sequence]

RWERKDCKPNSLPKLHKRHVKVGDTVKVISGGEKGKIGEISKIHKHNSTV
IIKDLNFKTKHVKSKEEGEQGQIIKIEAAIHSSNVMLILKEQEVADRVGH
KILEDVRKVRYLIKTGEIVDTPDR

3D structure

PDB

5x8p Unique localization of the plastid-specific ribosomal proteins in the chloroplast ribosome small subunit provides mechanistic insights into the chloroplastic translation

Chain

Resolution

3.4 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	V	E52 K54 K57 S60 L61 K66 H68 K70 V71 I78 S79 G80 G81 K83 I92 K107 T108 K109 H110 K112 G120 I122 H130 S132 N133 M135 R146 H149 K157 R159 D172	E3 K5 K8 S11 L12 K17 H19 K21 V22 I29 S30 G31 G32 K34 I43 K58 T59 K60 H61 K63 G71 I73 H81 S83 N84 M86 R97 H100 K108 R110 D123

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5x8p, PDBe:5x8p, PDBj:5x8p
PDBsum	5x8p
PubMed	28582576
UniProt	P27683\|RK24_SPIOL Large ribosomal subunit protein uL24c (Gene Name=RPL24)

[Back to BioLiP]