Structure of PDB 5x51 Chain V |
>5x51V (length=62) Species: 644223 (Komagataella phaffii GS115) [Search protein sequence] |
MIIPVRCFSCGKVVGDKWDAYLRLLEEGKQDALDELKLKRYCCRRMVLTH VDLIEKFLRYNP |
|
PDB | 5x51 Crystal structure of RNA polymerase II from Komagataella pastoris |
Chain | V |
Resolution | 6.996 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
V |
C7 C10 C44 C45 |
C7 C10 C42 C43 |
|
|
|
|