Structure of PDB 5umd Chain V

Receptor sequence

>5umdV (length=155) Species: 36329 (Plasmodium falciparum 3D7) [Search protein sequence]

KSRGKRSGTRYKFSKKFRKHGECTANKYLEKLNYGDYVDIVCDSTQQKGM
PFNYYHGKTGKIFHITKRGVGVLVNKRVKHRIEQKKVCVRIEHVRKSRCN
EDFLLRKIKNAELIKEAKLKNEHINIKRKTEGPKPAAMIKVPPSKIITIE
PLPFY

3D structure

PDB

5umd Mefloquine targets the Plasmodium falciparum 80S ribosome to inhibit protein synthesis.

Chain

Resolution

3.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	V	K4 S5 R6 G7 K8 R9 S10 G11 T12 R13 Y14 K15 S17 F20 H23 G24 Y40 S47 T48 Q50 K51 G52 F55 Y57 Y58 H59 G60 K61 T62 T69 K70 R71 G72 K79 V81 K82 H83 R84 E86 K88 K89 C91 R93 R98 R101 C102 D105 F106 R109 K110 I117 K121 I129 K130 R131 T133 P146 S147	K1 S2 R3 G4 K5 R6 S7 G8 T9 R10 Y11 K12 S14 F17 H20 G21 Y37 S44 T45 Q47 K48 G49 F52 Y54 Y55 H56 G57 K58 T59 T66 K67 R68 G69 K76 V78 K79 H80 R81 E83 K85 K86 C88 R90 R95 R98 C99 D102 F103 R106 K107 I114 K118 I126 K127 R128 T130 P143 S144
BS02	rna	V	R21 N29	R18 N26

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5umd, PDBe:5umd, PDBj:5umd
PDBsum	5umd
PubMed	28288098
UniProt	Q8ILK3

[Back to BioLiP]