Structure of PDB 5jbh Chain V

Receptor sequence

>5jbhV (length=99) Species: 272844 (Pyrococcus abyssi GE5)

MEIRIKEIKENKLIGRKEIYFEIYHPGEPTPSRKDVKGKLVAMLDLNPET
TVIQYIRSYFGSYISKGYAKAYDSKERMLYIEPEYILIRDGLIEKKEGE

3D structure

• PDB: 5jbh Cryo-EM study of start codon selection during archaeal translation initiation.
• Chain: V
• Resolution: 5.34 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	V	G27 E28 P29 S32 R33 S58 F60 G61 P83 E84 Y85 R89	G27 E28 P29 S32 R33 S58 F60 G61 P83 E84 Y85 R89

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5jbh, PDBe:5jbh, PDBj:5jbh
• PDBsum: 5jbh
• PubMed: 27819266
• UniProt: Q8U442|RS24_PYRFU Small ribosomal subunit protein eS24 (Gene Name=rps24e)