Structure of PDB 5gm6 Chain V

Receptor sequence
>5gm6V (length=128) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
NKIQQINDKELQSGILSPHQSWHNEYKDNAYIYIGNLNRELTEGDILTVF
SEYGVPVDVILSRDENTGESQGFAYLKYEDQRSTILAVDNLNGFKIGGRA
LKIDHTFYRPKRSLQKYYEAVKEELDRD
3D structure
PDB5gm6 Structure of a yeast activated spliceosome at 3.5 angstrom resolution
ChainV
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna V Y34 Y76 R100 T107 Y109 R110 P111 K112 Y33 Y75 R99 T106 Y108 R109 P110 K111
Gene Ontology
Molecular Function
GO:0000384 first spliceosomal transesterification activity
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0000245 spliceosomal complex assembly
GO:0000349 generation of catalytic spliceosome for first transesterification step
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0006406 mRNA export from nucleus
GO:0008380 RNA splicing
GO:0051237 maintenance of RNA location
GO:1903241 U2-type prespliceosome assembly
Cellular Component
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005686 U2 snRNP
GO:0005737 cytoplasm
GO:0070274 RES complex
GO:0071011 precatalytic spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5gm6, PDBe:5gm6, PDBj:5gm6
PDBsum5gm6
PubMed27445306
UniProtP40565|IST3_YEAST U2 snRNP component IST3 (Gene Name=IST3)

[Back to BioLiP]