Structure of PDB 4wfn Chain V

Receptor sequence

>4wfnV (length=65) Species: 243230 (Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539)

KPSEMRNLQATDFAKEIDARKKELMELRFQAAAGQLAQPHRVRQLRREVA
QLNTVKAELARKGEQ

3D structure

• PDB: 4wfn The Ribosomal Protein uL22 Modulates the Shape of the Protein Exit Tunnel.
• Chain: V
• Resolution: 3.54 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	V	Q39 P40 H41 R44 R47 R48 A51 Q52 N54 T55 E59	Q38 P39 H40 R43 R46 R47 A50 Q51 N53 T54 E58

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4wfn, PDBe:4wfn, PDBj:4wfn
• PDBsum: 4wfn
• PubMed: 28689968
• UniProt: Q9RXJ4|RL29_DEIRA Large ribosomal subunit protein uL29 (Gene Name=rpmC)