Structure of PDB 4v4i Chain V

Receptor sequence

>4v4iV (length=88) Species: 262724 (Thermus thermophilus HB27)

SGKRPIVANSIQRRGKAKREGGVGKKTTGISKRRQYPNLQKVRVRVAGQE
ITFRVAASHIPKVYELVERAKGLRLEGLSPKEIKKELL

3D structure

• PDB: 4v4i Crystal Structure of a 70S Ribosome-tRNA Complex Reveals Functional Interactions and Rearrangements
• Chain: V
• Resolution: 3.71 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	V	S8 N16 I18 Q19 R20 R21 K23 K25 G31 K32 K33 T34 T35 I37 S38 R40 R41 Q42 Y43 P44 N45 L46 Q47 R52 Q56 E57 R61 P68 A77 K92	S1 N9 I11 Q12 R13 R14 K16 K18 G24 K25 K26 T27 T28 I30 S31 R33 R34 Q35 Y36 P37 N38 L39 Q40 R45 Q49 E50 R54 P61 A70 K85
BS02	rna	V	R26 E27	R19 E20

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v4i, PDBe:4v4i, PDBj:4v4i
• PDBsum: 4v4i
• PubMed: 16962654
• UniProt: P60494|RL28_THET8 Large ribosomal subunit protein bL28 (Gene Name=rpmB)