Structure of PDB 4uuv Chain V

Receptor sequence
>4uuvV (length=94) Species: 9606 (Homo sapiens) [Search protein sequence]
LQLWQFLVALLDDPTNAHFIAWTGRGMEFKLIEPEEVARLWGIQKNRPAM
NYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCEPDALFSMAFPD
3D structure
PDB4uuv Structures of the Ets Domains of Transcription Factors Etv1, Etv4, Etv5 and Fev: Determinants of DNA Binding and Redox Regulation by Disulfide Bond Formation.
ChainV
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna V Y392 R397 R400 Y403 R415 Y416 Y52 R57 R60 Y63 R75 Y76
BS02 dna V Q342 L343 W381 K385 M390 D393 K394 S398 Y401 Y402 Q2 L3 W41 K45 M50 D53 K54 S58 Y61 Y62
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4uuv, PDBe:4uuv, PDBj:4uuv
PDBsum4uuv
PubMed25866208
UniProtP43268|ETV4_HUMAN ETS translocation variant 4 (Gene Name=ETV4)

[Back to BioLiP]