Structure of PDB 4io9 Chain V

Receptor sequence
>4io9V (length=66) Species: 1299 (Deinococcus radiodurans) [Search protein sequence]
MKPSEMRNLQATDFAKEIDARKKELMELRFQAAAGQLAQPHRVRQLRREV
AQLNTVKAELARKGEQ
3D structure
PDB4io9 Novel 3-O-carbamoyl erythromycin A derivatives (carbamolides) with activity against resistant staphylococcal and streptococcal isolates.
ChainV
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna V L37 Q39 P40 H41 R44 R47 R48 A51 Q52 N54 T55 L37 Q39 P40 H41 R44 R47 R48 A51 Q52 N54 T55
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4io9, PDBe:4io9, PDBj:4io9
PDBsum4io9
PubMed23414806
UniProtQ9RXJ4|RL29_DEIRA Large ribosomal subunit protein uL29 (Gene Name=rpmC)

[Back to BioLiP]