Structure of PDB 4il6 Chain V

Receptor sequence
>4il6V (length=137) Species: 32053 (Thermostichus vulcanus) [Search protein sequence]
AELTPEVLTVPLNSEGKTITLTEKQYLEGKRLFQYACASCHVGGITKTNP
SLDLRTETLALATPPRDNIEGLVDYMKNPTTYDGEQEIAEVHPSLRSADI
FPKMRNLTEKDLVAIAGHILVEPKILGDKWGGGKVYY
3D structure
PDB4il6 Structure of Sr-substituted photosystem II at 2.1 A resolution and its implications in the mechanism of water oxidation
ChainV
Resolution2.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 HEM V A36 C37 C40 H41 T46 L52 D53 L54 L59 Y75 M76 Y82 H92 P93 M104 A36 C37 C40 H41 T46 L52 D53 L54 L59 Y75 M76 Y82 H92 P93 M104
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0015979 photosynthesis
GO:0018063 cytochrome c-heme linkage
GO:0019684 photosynthesis, light reaction
GO:0022904 respiratory electron transport chain
Cellular Component
GO:0009523 photosystem II
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4il6, PDBe:4il6, PDBj:4il6
PDBsum4il6
PubMed23426624
UniProtP0A387|CY550_THEVL Photosystem II extrinsic protein V (Gene Name=psbV)

[Back to BioLiP]