Structure of PDB 4il6 Chain V

Receptor sequence

>4il6V (length=137) Species: 32053 (Thermostichus vulcanus)

AELTPEVLTVPLNSEGKTITLTEKQYLEGKRLFQYACASCHVGGITKTNP
SLDLRTETLALATPPRDNIEGLVDYMKNPTTYDGEQEIAEVHPSLRSADI
FPKMRNLTEKDLVAIAGHILVEPKILGDKWGGGKVYY

3D structure

• PDB: 4il6 Structure of Sr-substituted photosystem II at 2.1 A resolution and its implications in the mechanism of water oxidation
• Chain: V
• Resolution: 2.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	V	A36 C37 C40 H41 T46 L52 D53 L54 L59 Y75 M76 Y82 H92 P93 M104	A36 C37 C40 H41 T46 L52 D53 L54 L59 Y75 M76 Y82 H92 P93 M104

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0015979 photosynthesis
• GO:0018063 cytochrome c-heme linkage
• GO:0019684 photosynthesis, light reaction
• GO:0022904 respiratory electron transport chain

Cellular Component

• GO:0009523 photosystem II
• GO:0009579 thylakoid
• GO:0016020 membrane
• GO:0031676 plasma membrane-derived thylakoid membrane
• GO:0042651 thylakoid membrane

External links

• PDB: RCSB:4il6, PDBe:4il6, PDBj:4il6
• PDBsum: 4il6
• PubMed: 23426624
• UniProt: P0A387|CY550_THEVL Photosystem II extrinsic protein V (Gene Name=psbV)