Structure of PDB 3jcs Chain V

Receptor sequence

>3jcsV (length=118) Species: 5661 (Leishmania donovani) [Search protein sequence]

RKSYTRPQFRRPHTYRKPAMAKPSNRVTVESKDIAAFSVIRYPLTTDKAM
KKIEENNTLTFIVDSRANKTEIKKAMRKLYQVKAVKVNTLIRPDGLKKAY
IRLSAAHDALDTANKIGL

3D structure

PDB

3jcs 2.8- angstrom Cryo-EM Structure of the Large Ribosomal Subunit from the Eukaryotic Parasite Leishmania.

Chain

Resolution

2.8 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	V	R32 F35 R36 R37 P38 H39 Y41 R42 K43 A45 T72 K74 N82 K112 N114 T115 L116 P119 K124 Y126 R128	R6 F9 R10 R11 P12 H13 Y15 R16 K17 A19 T46 K48 N56 K86 N88 T89 L90 P93 K98 Y100 R102
BS02	rna	V	P33 Q34 N94 K95 K99 I117 K123	P7 Q8 N68 K69 K73 I91 K97
BS03	rna	V	K28 Y30 F35 P38 T40 Y41 N51 R52 S91 R92 N94 T96 E97 K100	K2 Y4 F9 P12 T14 Y15 N25 R26 S65 R66 N68 T70 E71 K74

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links