Structure of PDB 3j80 Chain V

Receptor sequence
>3j80V (length=87) Species: 28985 (Kluyveromyces lactis) [Search protein sequence]
MENDKGQLVELYVPRKCSATNRIIKAKDHSSVQINIAQVDEEGRAIPGEY
VTYALSGYIRARGEADDSLNRLAQQDGLLKNVWSYSR
3D structure
PDB3j80 Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
ChainV
Resolution3.75 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna V Y58 R62 Y58 R62
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000447 endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000461 endonucleolytic cleavage to generate mature 3'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006364 rRNA processing
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3j80, PDBe:3j80, PDBj:3j80
PDBsum3j80
PubMed25417110
UniProtQ6CXT6|RS21_KLULA Small ribosomal subunit protein eS21 (Gene Name=RPS21)

[Back to BioLiP]