Structure of PDB 2otj Chain V

Receptor sequence
>2otjV (length=65) Species: 2238 (Haloarcula marismortui) [Search protein sequence]
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELR
KAIARIKTIQGEEGD
3D structure
PDB2otj The Structures of Antibiotics Bound to the E Site Region of the 50 S Ribosomal Subunit of Haloarcula marismortui: 13-Deoxytedanolide and Girodazole.
ChainV
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna V T1 H4 E7 R9 Q34 P43 G44 K47 R50 K51 A54 R55 K57 T58 E62 T1 H4 E7 R9 Q34 P43 G44 K47 R50 K51 A54 R55 K57 T58 E62 PDBbind-CN: Kd=2nM
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2otj, PDBe:2otj, PDBj:2otj
PDBsum2otj
PubMed17321546
UniProtP10971|RL29_HALMA Large ribosomal subunit protein uL29 (Gene Name=rpl29)

[Back to BioLiP]