Structure of PDB 1yjn Chain V

Receptor sequence
>1yjnV (length=65) Species: 2238 (Haloarcula marismortui) [Search protein sequence]
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELR
KAIARIKTIQGEEGD
3D structure
PDB1yjn Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
ChainV
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna V T1 H4 E7 R9 Q34 G44 R50 K51 A54 R55 K57 T58 E62 T1 H4 E7 R9 Q34 G44 R50 K51 A54 R55 K57 T58 E62
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1yjn, PDBe:1yjn, PDBj:1yjn
PDBsum1yjn
PubMed15851032
UniProtP10971|RL29_HALMA Large ribosomal subunit protein uL29 (Gene Name=rpl29)

[Back to BioLiP]