Structure of PDB 1ryp Chain V

Receptor sequence

>1rypV (length=205) Species: 4932 (Saccharomyces cerevisiae)

LKKGEVSLGASIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKI
WCCRSGSAADTQAIADIVQYHLELYTSQYGTPSTETAASVFKELCYENKD
NLTAGIIVAGYDDKNKGEVYTIPLGGSVHKLPYAIAGSGSTFIYGYCDKN
FRENMSKEETVDFIKHSLSQAIKWDGSSGGVIRMVVLTAAGVERLIFYPD
EYEQL

3D structure

• PDB: 1ryp Structure of 20S proteasome from yeast at 2.4 A resolution.
• Chain: V
• Resolution: 1.9 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): A1 D17 R19 K33 G47 S129 D166 S169
• Catalytic site (residue number reindexed from 1): A10 D26 R28 K42 G56 S138 D175 S178
• Enzyme Commision number: 3.4.25.1: proteasome endopeptidase complex.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MG	V	I163 D166 S169	I172 D175 S178

Gene Ontology

Molecular Function

• GO:0004175 endopeptidase activity
• GO:0004298 threonine-type endopeptidase activity
• GO:0005515 protein binding

Biological Process

• GO:0006508 proteolysis
• GO:0010499 proteasomal ubiquitin-independent protein catabolic process
• GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process
• GO:0051603 proteolysis involved in protein catabolic process

Cellular Component

• GO:0000502 proteasome complex
• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005839 proteasome core complex
• GO:0019774 proteasome core complex, beta-subunit complex
• GO:0034515 proteasome storage granule

External links

• PDB: RCSB:1ryp, PDBe:1ryp, PDBj:1ryp
• PDBsum: 1ryp
• PubMed: 9087403
• UniProt: P38624|PSB1_YEAST Proteasome subunit beta type-1 (Gene Name=PRE3)