Structure of PDB 1kd1 Chain V

Receptor sequence

>1kd1V (length=53) Species: 2238 (Haloarcula marismortui)

RECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTD
TAR

3D structure

• PDB: 1kd1 The structures of four macrolide antibiotics bound to the large ribosomal subunit.
• Chain: V
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	V	S34 K35 N38 L42 R44 E50 W51 R56	S31 K32 N35 L39 R41 E47 W48 R53

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008270 zinc ion binding
• GO:0019843 rRNA binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:1kd1, PDBe:1kd1, PDBj:1kd1
• PDBsum: 1kd1
• PubMed: 12150912
• UniProt: P14116|RL24E_HALMA Large ribosomal subunit protein eL24 (Gene Name=rpl24e)