Structure of PDB 1k8a Chain V

Receptor sequence
>1k8aV (length=53) Species: 2238 (Haloarcula marismortui) [Search protein sequence]
RECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTD
TAR
3D structure
PDB1k8a The structures of four macrolide antibiotics bound to the large ribosomal subunit.
ChainV
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna V S34 K35 N38 L42 R44 E50 W51 R56 S31 K32 N35 L39 R41 E47 W48 R53
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
GO:0019843 rRNA binding
GO:0046872 metal ion binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1k8a, PDBe:1k8a, PDBj:1k8a
PDBsum1k8a
PubMed12150912
UniProtP14116|RL24E_HALMA Large ribosomal subunit protein eL24 (Gene Name=rpl24e)

[Back to BioLiP]